Anti RPL27A pAb (ATL-HPA060776)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060776-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RPL27A
Alternative Gene Name: L27A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046364: 97%, ENSRNOG00000031736: 96%
Entrez Gene ID: 6157
Uniprot ID: P46776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | INFDKYHPGYFGKVGMKHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLG |
| Gene Sequence | INFDKYHPGYFGKVGMKHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLG |
| Gene ID - Mouse | ENSMUSG00000046364 |
| Gene ID - Rat | ENSRNOG00000031736 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPL27A pAb (ATL-HPA060776) | |
| Datasheet | Anti RPL27A pAb (ATL-HPA060776) Datasheet (External Link) |
| Vendor Page | Anti RPL27A pAb (ATL-HPA060776) at Atlas Antibodies |
| Documents & Links for Anti RPL27A pAb (ATL-HPA060776) | |
| Datasheet | Anti RPL27A pAb (ATL-HPA060776) Datasheet (External Link) |
| Vendor Page | Anti RPL27A pAb (ATL-HPA060776) |