Anti RPL27A pAb (ATL-HPA060776)

Atlas Antibodies

Catalog No.:
ATL-HPA060776-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L27a
Gene Name: RPL27A
Alternative Gene Name: L27A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046364: 97%, ENSRNOG00000031736: 96%
Entrez Gene ID: 6157
Uniprot ID: P46776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen INFDKYHPGYFGKVGMKHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLG
Gene Sequence INFDKYHPGYFGKVGMKHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLG
Gene ID - Mouse ENSMUSG00000046364
Gene ID - Rat ENSRNOG00000031736
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPL27A pAb (ATL-HPA060776)
Datasheet Anti RPL27A pAb (ATL-HPA060776) Datasheet (External Link)
Vendor Page Anti RPL27A pAb (ATL-HPA060776) at Atlas Antibodies

Documents & Links for Anti RPL27A pAb (ATL-HPA060776)
Datasheet Anti RPL27A pAb (ATL-HPA060776) Datasheet (External Link)
Vendor Page Anti RPL27A pAb (ATL-HPA060776)