Anti RPL18A pAb (ATL-HPA055259)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055259-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RPL18A
Alternative Gene Name: L18A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045128: 98%, ENSRNOG00000018795: 98%
Entrez Gene ID: 6142
Uniprot ID: Q02543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF |
| Gene Sequence | RAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF |
| Gene ID - Mouse | ENSMUSG00000045128 |
| Gene ID - Rat | ENSRNOG00000018795 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPL18A pAb (ATL-HPA055259) | |
| Datasheet | Anti RPL18A pAb (ATL-HPA055259) Datasheet (External Link) |
| Vendor Page | Anti RPL18A pAb (ATL-HPA055259) at Atlas Antibodies |
| Documents & Links for Anti RPL18A pAb (ATL-HPA055259) | |
| Datasheet | Anti RPL18A pAb (ATL-HPA055259) Datasheet (External Link) |
| Vendor Page | Anti RPL18A pAb (ATL-HPA055259) |
| Citations for Anti RPL18A pAb (ATL-HPA055259) – 1 Found |
| Kawada, Manabu; Inoue, Hiroyuki; Ohba, Shun-ichi; Yoshida, Junjiro; Masuda, Tohru; Yamasaki, Manabu; Usami, Ihomi; Sakamoto, Shuichi; Abe, Hikaru; Watanabe, Takumi; Yamori, Takao; Shibasaki, Masakatsu; Nomoto, Akio. Stromal cells positively and negatively modulate the growth of cancer cells: stimulation via the PGE2-TNFα-IL-6 pathway and inhibition via secreted GAPDH-E-cadherin interaction. Plos One. 10(3):e0119415. PubMed |