Anti RPL18A pAb (ATL-HPA055259)

Atlas Antibodies

Catalog No.:
ATL-HPA055259-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L18a
Gene Name: RPL18A
Alternative Gene Name: L18A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045128: 98%, ENSRNOG00000018795: 98%
Entrez Gene ID: 6142
Uniprot ID: Q02543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF
Gene Sequence RAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF
Gene ID - Mouse ENSMUSG00000045128
Gene ID - Rat ENSRNOG00000018795
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPL18A pAb (ATL-HPA055259)
Datasheet Anti RPL18A pAb (ATL-HPA055259) Datasheet (External Link)
Vendor Page Anti RPL18A pAb (ATL-HPA055259) at Atlas Antibodies

Documents & Links for Anti RPL18A pAb (ATL-HPA055259)
Datasheet Anti RPL18A pAb (ATL-HPA055259) Datasheet (External Link)
Vendor Page Anti RPL18A pAb (ATL-HPA055259)
Citations for Anti RPL18A pAb (ATL-HPA055259) – 1 Found
Kawada, Manabu; Inoue, Hiroyuki; Ohba, Shun-ichi; Yoshida, Junjiro; Masuda, Tohru; Yamasaki, Manabu; Usami, Ihomi; Sakamoto, Shuichi; Abe, Hikaru; Watanabe, Takumi; Yamori, Takao; Shibasaki, Masakatsu; Nomoto, Akio. Stromal cells positively and negatively modulate the growth of cancer cells: stimulation via the PGE2-TNFα-IL-6 pathway and inhibition via secreted GAPDH-E-cadherin interaction. Plos One. 10(3):e0119415.  PubMed