Anti RPL11 pAb (ATL-HPA074839)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074839-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: RPL11
Alternative Gene Name: L11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059291: 100%, ENSRNOG00000026260: 100%
Entrez Gene ID: 6135
Uniprot ID: P62913
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTR |
| Gene Sequence | MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTR |
| Gene ID - Mouse | ENSMUSG00000059291 |
| Gene ID - Rat | ENSRNOG00000026260 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPL11 pAb (ATL-HPA074839) | |
| Datasheet | Anti RPL11 pAb (ATL-HPA074839) Datasheet (External Link) |
| Vendor Page | Anti RPL11 pAb (ATL-HPA074839) at Atlas Antibodies |
| Documents & Links for Anti RPL11 pAb (ATL-HPA074839) | |
| Datasheet | Anti RPL11 pAb (ATL-HPA074839) Datasheet (External Link) |
| Vendor Page | Anti RPL11 pAb (ATL-HPA074839) |