Anti RPGRIP1L pAb (ATL-HPA040530)

Atlas Antibodies

Catalog No.: ATL-HPA040530-25

Protein Description: RPGRIP1-like
Gene Name: RPGRIP1L
Alternative Gene Name: CORS3, FTM, JBTS7, KIAA1005, MKS5, NPHP8, PPP1R134
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033282: 95%, ENSRNOG00000011829: 94%
Entrez Gene ID: 23322
Uniprot ID: Q68CZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TKYGNSLLEEARGEIRNLENVIQSQRGQIEELEHLAEILKTQLRRKENEIELSLLQLREQQATDQRSNIRDNVEMIKLHKQLVEKSNALSAMEGKFIQLQEKQRTLRIS
• Gene Sequence: TKYGNSLLEEARGEIRNLENVIQSQRGQIEELEHLAEILKTQLRRKENEIELSLLQLREQQATDQRSNIRDNVEMIKLHKQLVEKSNALSAMEGKFIQLQEKQRTLRIS
• Gene ID - Mouse: ENSMUSG00000033282
• Gene ID - Rat: ENSRNOG00000011829
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.