Anti RPGRIP1L pAb (ATL-HPA039405)

Atlas Antibodies

Catalog No.:
ATL-HPA039405-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RPGRIP1-like
Gene Name: RPGRIP1L
Alternative Gene Name: CORS3, FTM, JBTS7, KIAA1005, MKS5, NPHP8, PPP1R134
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033282: 85%, ENSRNOG00000011829: 87%
Entrez Gene ID: 23322
Uniprot ID: Q68CZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KNTITLEVHQAYSTEYETIAACQLKFHEILEKSGRIFCTASLIGTKGDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAPKTAQLSSTDSTDGNL
Gene Sequence KNTITLEVHQAYSTEYETIAACQLKFHEILEKSGRIFCTASLIGTKGDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAPKTAQLSSTDSTDGNL
Gene ID - Mouse ENSMUSG00000033282
Gene ID - Rat ENSRNOG00000011829
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPGRIP1L pAb (ATL-HPA039405)
Datasheet Anti RPGRIP1L pAb (ATL-HPA039405) Datasheet (External Link)
Vendor Page Anti RPGRIP1L pAb (ATL-HPA039405) at Atlas Antibodies

Documents & Links for Anti RPGRIP1L pAb (ATL-HPA039405)
Datasheet Anti RPGRIP1L pAb (ATL-HPA039405) Datasheet (External Link)
Vendor Page Anti RPGRIP1L pAb (ATL-HPA039405)
Citations for Anti RPGRIP1L pAb (ATL-HPA039405) – 5 Found
Zhang, Qihong; Giacalone, Joseph C; Searby, Charles; Stone, Edwin M; Tucker, Budd A; Sheffield, Val C. Disruption of RPGR protein interaction network is the common feature of RPGR missense variations that cause XLRP. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2019;116(4):1353-1360.  PubMed
Wang, Won-Jing; Tay, Hwee Goon; Soni, Rajesh; Perumal, Geoffrey S; Goll, Mary G; Macaluso, Frank P; Asara, John M; Amack, Jeffrey D; Tsou, Meng-Fu Bryan. CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base. Nature Cell Biology. 2013;15(6):591-601.  PubMed
Yang, T Tony; Su, Jimmy; Wang, Won-Jing; Craige, Branch; Witman, George B; Tsou, Meng-Fu Bryan; Liao, Jung-Chi. Superresolution Pattern Recognition Reveals the Architectural Map of the Ciliary Transition Zone. Scientific Reports. 2015;5( 26365165):14096.  PubMed
Guo, Jiani; Yang, Yu; Ji, Zhuqing; Yao, Mengchu; Xia, Xiaotian; Sha, Xiaofeng; Huang, Mingde. Case Report: Novel RPGRIP1L Gene Mutations Identified by Whole Exome Sequencing in a Patient With Multiple Primary Tumors. Frontiers In Genetics. 12( 33597970):620472.  PubMed
Shen, Xiao-Lin; Yuan, Jin-Feng; Qin, Xuan-He; Song, Guang-Ping; Hu, Huai-Bin; Tu, Hai-Qing; Song, Zeng-Qing; Li, Pei-Yao; Xu, Yu-Ling; Li, Sen; Jian, Xiao-Xiao; Li, Jia-Ning; He, Chun-Yu; Yu, Xi-Ping; Liang, Li-Yun; Wu, Min; Han, Qiu-Ying; Wang, Kai; Li, Ai-Ling; Zhou, Tao; Zhang, Yu-Cheng; Wang, Na; Li, Hui-Yan. LUBAC regulates ciliogenesis by promoting CP110 removal from the mother centriole. The Journal Of Cell Biology. 2022;221(1)  PubMed