Anti RPA4 pAb (ATL-HPA066010)

Atlas Antibodies

Catalog No.:
ATL-HPA066010-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: replication protein A4, 30kDa
Gene Name: RPA4
Alternative Gene Name: HSU24186
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028884: 38%, ENSRNOG00000013005: 41%
Entrez Gene ID: 29935
Uniprot ID: Q13156
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQV
Gene Sequence MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQV
Gene ID - Mouse ENSMUSG00000028884
Gene ID - Rat ENSRNOG00000013005
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPA4 pAb (ATL-HPA066010)
Datasheet Anti RPA4 pAb (ATL-HPA066010) Datasheet (External Link)
Vendor Page Anti RPA4 pAb (ATL-HPA066010) at Atlas Antibodies

Documents & Links for Anti RPA4 pAb (ATL-HPA066010)
Datasheet Anti RPA4 pAb (ATL-HPA066010) Datasheet (External Link)
Vendor Page Anti RPA4 pAb (ATL-HPA066010)