Anti RP9 pAb (ATL-HPA050778)

Atlas Antibodies

Catalog No.:
ATL-HPA050778-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: retinitis pigmentosa 9 (autosomal dominant)
Gene Name: RP9
Alternative Gene Name: PAP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032239: 97%, ENSRNOG00000029456: 80%
Entrez Gene ID: 6100
Uniprot ID: Q8TA86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKEVKVMQCWRCKRYGHRTGDKECPFFIKGNQKLEQFRVAHEDPMYDIIRDNKRHEKDVRIQQLKQLLEDSTSD
Gene Sequence GKEVKVMQCWRCKRYGHRTGDKECPFFIKGNQKLEQFRVAHEDPMYDIIRDNKRHEKDVRIQQLKQLLEDSTSD
Gene ID - Mouse ENSMUSG00000032239
Gene ID - Rat ENSRNOG00000029456
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RP9 pAb (ATL-HPA050778)
Datasheet Anti RP9 pAb (ATL-HPA050778) Datasheet (External Link)
Vendor Page Anti RP9 pAb (ATL-HPA050778) at Atlas Antibodies

Documents & Links for Anti RP9 pAb (ATL-HPA050778)
Datasheet Anti RP9 pAb (ATL-HPA050778) Datasheet (External Link)
Vendor Page Anti RP9 pAb (ATL-HPA050778)