Anti RP2 pAb (ATL-HPA000234)

Atlas Antibodies

Catalog No.: ATL-HPA000234-25

Protein Description: retinitis pigmentosa 2 (X-linked recessive)
Gene Name: RP2
Alternative Gene Name: NM23-H10, NME10, TBCCD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060090: 88%, ENSRNOG00000025428: 87%
Entrez Gene ID: 6102
Uniprot ID: O75695
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALE
• Gene Sequence: ELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALE
• Gene ID - Mouse: ENSMUSG00000060090
• Gene ID - Rat: ENSRNOG00000025428
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RP2 pAb (ATL-HPA000234) – 1 Found

Travis, Amanda M; Manocha, Samiya; Willer, Jason R; Wessler, Timothy S; Skiba, Nikolai P; Pearring, Jillian N. Disrupting the ciliary gradient of active Arl3 affects rod photoreceptor nuclear migration. Elife. 2023;12( 36598133)