Anti RP11-849H4.2 pAb (ATL-HPA051121)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051121-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: RP11-849H4.2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070425: 56%, ENSRNOG00000020188: 28%
Entrez Gene ID:
Uniprot ID: Q6ZNB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QIDVGHSSWPLDRPFITLLPATTLMSLTDSKQGKNRSGVRMFKDGKEGKSRKDGGGLYEKQRCSTKEDCEC |
| Gene Sequence | QIDVGHSSWPLDRPFITLLPATTLMSLTDSKQGKNRSGVRMFKDGKEGKSRKDGGGLYEKQRCSTKEDCEC |
| Gene ID - Mouse | ENSMUSG00000070425 |
| Gene ID - Rat | ENSRNOG00000020188 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RP11-849H4.2 pAb (ATL-HPA051121) | |
| Datasheet | Anti RP11-849H4.2 pAb (ATL-HPA051121) Datasheet (External Link) |
| Vendor Page | Anti RP11-849H4.2 pAb (ATL-HPA051121) at Atlas Antibodies |
| Documents & Links for Anti RP11-849H4.2 pAb (ATL-HPA051121) | |
| Datasheet | Anti RP11-849H4.2 pAb (ATL-HPA051121) Datasheet (External Link) |
| Vendor Page | Anti RP11-849H4.2 pAb (ATL-HPA051121) |