Anti RP11-849H4.2 pAb (ATL-HPA051121)

Atlas Antibodies

Catalog No.:
ATL-HPA051121-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: Putative short transient receptor potential channel 2-like protein
Gene Name: RP11-849H4.2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070425: 56%, ENSRNOG00000020188: 28%
Entrez Gene ID:
Uniprot ID: Q6ZNB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QIDVGHSSWPLDRPFITLLPATTLMSLTDSKQGKNRSGVRMFKDGKEGKSRKDGGGLYEKQRCSTKEDCEC
Gene Sequence QIDVGHSSWPLDRPFITLLPATTLMSLTDSKQGKNRSGVRMFKDGKEGKSRKDGGGLYEKQRCSTKEDCEC
Gene ID - Mouse ENSMUSG00000070425
Gene ID - Rat ENSRNOG00000020188
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RP11-849H4.2 pAb (ATL-HPA051121)
Datasheet Anti RP11-849H4.2 pAb (ATL-HPA051121) Datasheet (External Link)
Vendor Page Anti RP11-849H4.2 pAb (ATL-HPA051121) at Atlas Antibodies

Documents & Links for Anti RP11-849H4.2 pAb (ATL-HPA051121)
Datasheet Anti RP11-849H4.2 pAb (ATL-HPA051121) Datasheet (External Link)
Vendor Page Anti RP11-849H4.2 pAb (ATL-HPA051121)