Anti RP11-80H18.3 pAb (ATL-HPA066812)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066812-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: RP11-80H18.3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023156: 94%, ENSRNOG00000038872: 29%
Entrez Gene ID:
Uniprot ID: P86397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VHGVLINGLISALLGTKMPGPGCVFLSQEISFPAPLYIGEVVLASAEVKKL |
| Gene Sequence | VHGVLINGLISALLGTKMPGPGCVFLSQEISFPAPLYIGEVVLASAEVKKL |
| Gene ID - Mouse | ENSMUSG00000023156 |
| Gene ID - Rat | ENSRNOG00000038872 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RP11-80H18.3 pAb (ATL-HPA066812) | |
| Datasheet | Anti RP11-80H18.3 pAb (ATL-HPA066812) Datasheet (External Link) |
| Vendor Page | Anti RP11-80H18.3 pAb (ATL-HPA066812) at Atlas Antibodies |
| Documents & Links for Anti RP11-80H18.3 pAb (ATL-HPA066812) | |
| Datasheet | Anti RP11-80H18.3 pAb (ATL-HPA066812) Datasheet (External Link) |
| Vendor Page | Anti RP11-80H18.3 pAb (ATL-HPA066812) |