Anti RP11-80H18.3 pAb (ATL-HPA066812)

Atlas Antibodies

Catalog No.:
ATL-HPA066812-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: Hydroxyacyl-thioester dehydratase type 2, mitochondrial
Gene Name: RP11-80H18.3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023156: 94%, ENSRNOG00000038872: 29%
Entrez Gene ID:
Uniprot ID: P86397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VHGVLINGLISALLGTKMPGPGCVFLSQEISFPAPLYIGEVVLASAEVKKL
Gene Sequence VHGVLINGLISALLGTKMPGPGCVFLSQEISFPAPLYIGEVVLASAEVKKL
Gene ID - Mouse ENSMUSG00000023156
Gene ID - Rat ENSRNOG00000038872
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RP11-80H18.3 pAb (ATL-HPA066812)
Datasheet Anti RP11-80H18.3 pAb (ATL-HPA066812) Datasheet (External Link)
Vendor Page Anti RP11-80H18.3 pAb (ATL-HPA066812) at Atlas Antibodies

Documents & Links for Anti RP11-80H18.3 pAb (ATL-HPA066812)
Datasheet Anti RP11-80H18.3 pAb (ATL-HPA066812) Datasheet (External Link)
Vendor Page Anti RP11-80H18.3 pAb (ATL-HPA066812)