Anti RP11-302B13.5 pAb (ATL-HPA068942)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068942-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: RP11-302B13.5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025422: 33%, ENSRNOG00000060594: 33%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YKPSSEPLGSPRSSKREPRSLSGTSLTDMSKLSVTGGNPEVLTTGFVEGSRVRS |
| Gene Sequence | YKPSSEPLGSPRSSKREPRSLSGTSLTDMSKLSVTGGNPEVLTTGFVEGSRVRS |
| Gene ID - Mouse | ENSMUSG00000025422 |
| Gene ID - Rat | ENSRNOG00000060594 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RP11-302B13.5 pAb (ATL-HPA068942) | |
| Datasheet | Anti RP11-302B13.5 pAb (ATL-HPA068942) Datasheet (External Link) |
| Vendor Page | Anti RP11-302B13.5 pAb (ATL-HPA068942) at Atlas Antibodies |
| Documents & Links for Anti RP11-302B13.5 pAb (ATL-HPA068942) | |
| Datasheet | Anti RP11-302B13.5 pAb (ATL-HPA068942) Datasheet (External Link) |
| Vendor Page | Anti RP11-302B13.5 pAb (ATL-HPA068942) |