Anti RP11-302B13.5 pAb (ATL-HPA068942)

Atlas Antibodies

Catalog No.:
ATL-HPA068942-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description:
Gene Name: RP11-302B13.5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025422: 33%, ENSRNOG00000060594: 33%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YKPSSEPLGSPRSSKREPRSLSGTSLTDMSKLSVTGGNPEVLTTGFVEGSRVRS
Gene Sequence YKPSSEPLGSPRSSKREPRSLSGTSLTDMSKLSVTGGNPEVLTTGFVEGSRVRS
Gene ID - Mouse ENSMUSG00000025422
Gene ID - Rat ENSRNOG00000060594
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RP11-302B13.5 pAb (ATL-HPA068942)
Datasheet Anti RP11-302B13.5 pAb (ATL-HPA068942) Datasheet (External Link)
Vendor Page Anti RP11-302B13.5 pAb (ATL-HPA068942) at Atlas Antibodies

Documents & Links for Anti RP11-302B13.5 pAb (ATL-HPA068942)
Datasheet Anti RP11-302B13.5 pAb (ATL-HPA068942) Datasheet (External Link)
Vendor Page Anti RP11-302B13.5 pAb (ATL-HPA068942)