Anti RP11-111M22.2 pAb (ATL-HPA057405)

Atlas Antibodies

Catalog No.:
ATL-HPA057405-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description:
Gene Name: RP11-111M22.2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095567: 22%, ENSRNOG00000021392: 26%
Entrez Gene ID: 100506127
Uniprot ID: Q3ZCU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RYLEQRISIKFCVKLNKSASETHHLLKEAYGDEVMSRARVFDWHKRFKEGREDVRDDARSGRPVTHRTDDNIQKVKDLVCS
Gene Sequence RYLEQRISIKFCVKLNKSASETHHLLKEAYGDEVMSRARVFDWHKRFKEGREDVRDDARSGRPVTHRTDDNIQKVKDLVCS
Gene ID - Mouse ENSMUSG00000095567
Gene ID - Rat ENSRNOG00000021392
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RP11-111M22.2 pAb (ATL-HPA057405)
Datasheet Anti RP11-111M22.2 pAb (ATL-HPA057405) Datasheet (External Link)
Vendor Page Anti RP11-111M22.2 pAb (ATL-HPA057405) at Atlas Antibodies

Documents & Links for Anti RP11-111M22.2 pAb (ATL-HPA057405)
Datasheet Anti RP11-111M22.2 pAb (ATL-HPA057405) Datasheet (External Link)
Vendor Page Anti RP11-111M22.2 pAb (ATL-HPA057405)