Anti RORC pAb (ATL-HPA065620)

Atlas Antibodies

Catalog No.:
ATL-HPA065620-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: RAR-related orphan receptor C
Gene Name: RORC
Alternative Gene Name: NR1F3, RORG, RZRG, TOR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028150: 87%, ENSRNOG00000020836: 89%
Entrez Gene ID: 6097
Uniprot ID: P51449
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYV
Gene Sequence FRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYV
Gene ID - Mouse ENSMUSG00000028150
Gene ID - Rat ENSRNOG00000020836
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RORC pAb (ATL-HPA065620)
Datasheet Anti RORC pAb (ATL-HPA065620) Datasheet (External Link)
Vendor Page Anti RORC pAb (ATL-HPA065620) at Atlas Antibodies

Documents & Links for Anti RORC pAb (ATL-HPA065620)
Datasheet Anti RORC pAb (ATL-HPA065620) Datasheet (External Link)
Vendor Page Anti RORC pAb (ATL-HPA065620)