Anti RORC pAb (ATL-HPA065620)

Atlas Antibodies

Catalog No.: ATL-HPA065620-25

Protein Description: RAR-related orphan receptor C
Gene Name: RORC
Alternative Gene Name: NR1F3, RORG, RZRG, TOR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028150: 87%, ENSRNOG00000020836: 89%
Entrez Gene ID: 6097
Uniprot ID: P51449
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYV
• Gene Sequence: FRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYV
• Gene ID - Mouse: ENSMUSG00000028150
• Gene ID - Rat: ENSRNOG00000020836
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.