Anti ROPN1B pAb (ATL-HPA052530)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052530-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ROPN1B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022832: 76%, ENSRNOG00000002187: 78%
Entrez Gene ID: 152015
Uniprot ID: Q9BZX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPELLKIL |
| Gene Sequence | QDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPELLKIL |
| Gene ID - Mouse | ENSMUSG00000022832 |
| Gene ID - Rat | ENSRNOG00000002187 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ROPN1B pAb (ATL-HPA052530) | |
| Datasheet | Anti ROPN1B pAb (ATL-HPA052530) Datasheet (External Link) |
| Vendor Page | Anti ROPN1B pAb (ATL-HPA052530) at Atlas Antibodies |
| Documents & Links for Anti ROPN1B pAb (ATL-HPA052530) | |
| Datasheet | Anti ROPN1B pAb (ATL-HPA052530) Datasheet (External Link) |
| Vendor Page | Anti ROPN1B pAb (ATL-HPA052530) |