Anti ROPN1B pAb (ATL-HPA052530)

Atlas Antibodies

Catalog No.:
ATL-HPA052530-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: rhophilin associated tail protein 1B
Gene Name: ROPN1B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022832: 76%, ENSRNOG00000002187: 78%
Entrez Gene ID: 152015
Uniprot ID: Q9BZX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPELLKIL
Gene Sequence QDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPELLKIL
Gene ID - Mouse ENSMUSG00000022832
Gene ID - Rat ENSRNOG00000002187
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ROPN1B pAb (ATL-HPA052530)
Datasheet Anti ROPN1B pAb (ATL-HPA052530) Datasheet (External Link)
Vendor Page Anti ROPN1B pAb (ATL-HPA052530) at Atlas Antibodies

Documents & Links for Anti ROPN1B pAb (ATL-HPA052530)
Datasheet Anti ROPN1B pAb (ATL-HPA052530) Datasheet (External Link)
Vendor Page Anti ROPN1B pAb (ATL-HPA052530)