Anti ROM1 pAb (ATL-HPA073279)

Atlas Antibodies

Catalog No.: ATL-HPA073279-25

Protein Description: retinal outer segment membrane protein 1
Gene Name: ROM1
Alternative Gene Name: ROM, TSPAN23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071648: 82%, ENSRNOG00000019858: 80%
Entrez Gene ID: 6094
Uniprot ID: Q03395
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RYLQTALEGLGGVIDAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSEA
• Gene Sequence: RYLQTALEGLGGVIDAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSEA
• Gene ID - Mouse: ENSMUSG00000071648
• Gene ID - Rat: ENSRNOG00000019858
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.