Anti ROBO4 pAb (ATL-HPA065212)

Atlas Antibodies

Catalog No.:
ATL-HPA065212-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: roundabout guidance receptor 4
Gene Name: ROBO4
Alternative Gene Name: ECSM4, FLJ20798, MRB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032125: 81%, ENSRNOG00000050964: 84%
Entrez Gene ID: 54538
Uniprot ID: Q8WZ75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQVAAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPW
Gene Sequence PAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQVAAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPW
Gene ID - Mouse ENSMUSG00000032125
Gene ID - Rat ENSRNOG00000050964
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ROBO4 pAb (ATL-HPA065212)
Datasheet Anti ROBO4 pAb (ATL-HPA065212) Datasheet (External Link)
Vendor Page Anti ROBO4 pAb (ATL-HPA065212) at Atlas Antibodies

Documents & Links for Anti ROBO4 pAb (ATL-HPA065212)
Datasheet Anti ROBO4 pAb (ATL-HPA065212) Datasheet (External Link)
Vendor Page Anti ROBO4 pAb (ATL-HPA065212)
Citations for Anti ROBO4 pAb (ATL-HPA065212) – 1 Found
Pircher, Andreas; Schäfer, Georg; Eigentler, Andrea; Pichler, Renate; Puhr, Martin; Steiner, Eberhard; Horninger, Wolfgang; Gunsilius, Eberhard; Klocker, Helmut; Heidegger, Isabel. Robo 4 - the double-edged sword in prostate cancer: impact on cancer cell aggressiveness and tumor vasculature. International Journal Of Medical Sciences. 16(1):115-124.  PubMed