Anti ROBO4 pAb (ATL-HPA065212)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065212-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ROBO4
Alternative Gene Name: ECSM4, FLJ20798, MRB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032125: 81%, ENSRNOG00000050964: 84%
Entrez Gene ID: 54538
Uniprot ID: Q8WZ75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQVAAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPW |
Gene Sequence | PAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQVAAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPW |
Gene ID - Mouse | ENSMUSG00000032125 |
Gene ID - Rat | ENSRNOG00000050964 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ROBO4 pAb (ATL-HPA065212) | |
Datasheet | Anti ROBO4 pAb (ATL-HPA065212) Datasheet (External Link) |
Vendor Page | Anti ROBO4 pAb (ATL-HPA065212) at Atlas Antibodies |
Documents & Links for Anti ROBO4 pAb (ATL-HPA065212) | |
Datasheet | Anti ROBO4 pAb (ATL-HPA065212) Datasheet (External Link) |
Vendor Page | Anti ROBO4 pAb (ATL-HPA065212) |
Citations for Anti ROBO4 pAb (ATL-HPA065212) – 1 Found |
Pircher, Andreas; Schäfer, Georg; Eigentler, Andrea; Pichler, Renate; Puhr, Martin; Steiner, Eberhard; Horninger, Wolfgang; Gunsilius, Eberhard; Klocker, Helmut; Heidegger, Isabel. Robo 4 - the double-edged sword in prostate cancer: impact on cancer cell aggressiveness and tumor vasculature. International Journal Of Medical Sciences. 16(1):115-124. PubMed |