Anti ROBO4 pAb (ATL-HPA065212)

Atlas Antibodies

Catalog No.: ATL-HPA065212-25

Protein Description: roundabout guidance receptor 4
Gene Name: ROBO4
Alternative Gene Name: ECSM4, FLJ20798, MRB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032125: 81%, ENSRNOG00000050964: 84%
Entrez Gene ID: 54538
Uniprot ID: Q8WZ75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQVAAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPW
• Gene Sequence: PAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQVAAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPW
• Gene ID - Mouse: ENSMUSG00000032125
• Gene ID - Rat: ENSRNOG00000050964
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ROBO4 pAb (ATL-HPA065212) – 1 Found

Pircher, Andreas; Schäfer, Georg; Eigentler, Andrea; Pichler, Renate; Puhr, Martin; Steiner, Eberhard; Horninger, Wolfgang; Gunsilius, Eberhard; Klocker, Helmut; Heidegger, Isabel. Robo 4 - the double-edged sword in prostate cancer: impact on cancer cell aggressiveness and tumor vasculature. International Journal Of Medical Sciences. 16(1):115-124.