Anti RNPEPL1 pAb (ATL-HPA036773)

Atlas Antibodies

Catalog No.:
ATL-HPA036773-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: arginyl aminopeptidase like 1
Gene Name: RNPEPL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026269: 100%, ENSRNOG00000045775: 97%
Entrez Gene ID: 57140
Uniprot ID: Q9HAU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPQEVVMSLSKCYSSLLDSMNAEIRIRWLQIVVRNDYYPDLHRVRRFLESQMSRMYTIPLYEDLCTGALKSFA
Gene Sequence LPQEVVMSLSKCYSSLLDSMNAEIRIRWLQIVVRNDYYPDLHRVRRFLESQMSRMYTIPLYEDLCTGALKSFA
Gene ID - Mouse ENSMUSG00000026269
Gene ID - Rat ENSRNOG00000045775
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNPEPL1 pAb (ATL-HPA036773)
Datasheet Anti RNPEPL1 pAb (ATL-HPA036773) Datasheet (External Link)
Vendor Page Anti RNPEPL1 pAb (ATL-HPA036773) at Atlas Antibodies

Documents & Links for Anti RNPEPL1 pAb (ATL-HPA036773)
Datasheet Anti RNPEPL1 pAb (ATL-HPA036773) Datasheet (External Link)
Vendor Page Anti RNPEPL1 pAb (ATL-HPA036773)