Anti RNPEP pAb (ATL-HPA061487)
Atlas Antibodies
- SKU:
- ATL-HPA061487-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RNPEP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041926: 84%, ENSRNOG00000006720: 87%
Entrez Gene ID: 6051
Uniprot ID: Q9H4A4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPK |
| Gene Sequence | KNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPK |
| Gene ID - Mouse | ENSMUSG00000041926 |
| Gene ID - Rat | ENSRNOG00000006720 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RNPEP pAb (ATL-HPA061487) | |
| Datasheet | Anti RNPEP pAb (ATL-HPA061487) Datasheet (External Link) |
| Vendor Page | Anti RNPEP pAb (ATL-HPA061487) at Atlas Antibodies |
| Documents & Links for Anti RNPEP pAb (ATL-HPA061487) | |
| Datasheet | Anti RNPEP pAb (ATL-HPA061487) Datasheet (External Link) |
| Vendor Page | Anti RNPEP pAb (ATL-HPA061487) |
| Citations for Anti RNPEP pAb (ATL-HPA061487) – 1 Found |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |