Anti RNPC3 pAb (ATL-HPA052434)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052434-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RNPC3
Alternative Gene Name: FLJ20008, KIAA1839, RBM40, SNRNP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027981: 87%, ENSRNOG00000017310: 85%
Entrez Gene ID: 55599
Uniprot ID: Q96LT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAAPEQPLAISRGCTSSSSLSPPRGDRTLLVRHLPAELTAEEKEDLLKYFGAQSVRVLSDKGRLKHTA |
Gene Sequence | MAAPEQPLAISRGCTSSSSLSPPRGDRTLLVRHLPAELTAEEKEDLLKYFGAQSVRVLSDKGRLKHTA |
Gene ID - Mouse | ENSMUSG00000027981 |
Gene ID - Rat | ENSRNOG00000017310 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RNPC3 pAb (ATL-HPA052434) | |
Datasheet | Anti RNPC3 pAb (ATL-HPA052434) Datasheet (External Link) |
Vendor Page | Anti RNPC3 pAb (ATL-HPA052434) at Atlas Antibodies |
Documents & Links for Anti RNPC3 pAb (ATL-HPA052434) | |
Datasheet | Anti RNPC3 pAb (ATL-HPA052434) Datasheet (External Link) |
Vendor Page | Anti RNPC3 pAb (ATL-HPA052434) |