Anti RNPC3 pAb (ATL-HPA052434)

Atlas Antibodies

Catalog No.:
ATL-HPA052434-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: RNA-binding region (RNP1, RRM) containing 3
Gene Name: RNPC3
Alternative Gene Name: FLJ20008, KIAA1839, RBM40, SNRNP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027981: 87%, ENSRNOG00000017310: 85%
Entrez Gene ID: 55599
Uniprot ID: Q96LT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAAPEQPLAISRGCTSSSSLSPPRGDRTLLVRHLPAELTAEEKEDLLKYFGAQSVRVLSDKGRLKHTA
Gene Sequence MAAPEQPLAISRGCTSSSSLSPPRGDRTLLVRHLPAELTAEEKEDLLKYFGAQSVRVLSDKGRLKHTA
Gene ID - Mouse ENSMUSG00000027981
Gene ID - Rat ENSRNOG00000017310
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNPC3 pAb (ATL-HPA052434)
Datasheet Anti RNPC3 pAb (ATL-HPA052434) Datasheet (External Link)
Vendor Page Anti RNPC3 pAb (ATL-HPA052434) at Atlas Antibodies

Documents & Links for Anti RNPC3 pAb (ATL-HPA052434)
Datasheet Anti RNPC3 pAb (ATL-HPA052434) Datasheet (External Link)
Vendor Page Anti RNPC3 pAb (ATL-HPA052434)