Anti RNF44 pAb (ATL-HPA038981)

Atlas Antibodies

Catalog No.: ATL-HPA038981-25

Protein Description: ring finger protein 44
Gene Name: RNF44
Alternative Gene Name: KIAA1100
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034928: 75%, ENSRNOG00000028892: 38%
Entrez Gene ID: 22838
Uniprot ID: Q7L0R7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MRPWALAVTRWPPSAPVGQRRFSAGPGSTPGQLWGSPGLEGPLASPPARDERLPSQQPPSRPPHLPVEERRASAPAGGSPRMLHPATQ
• Gene Sequence: MRPWALAVTRWPPSAPVGQRRFSAGPGSTPGQLWGSPGLEGPLASPPARDERLPSQQPPSRPPHLPVEERRASAPAGGSPRMLHPATQ
• Gene ID - Mouse: ENSMUSG00000034928
• Gene ID - Rat: ENSRNOG00000028892
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.