Anti RNF44 pAb (ATL-HPA038981)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038981-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RNF44
Alternative Gene Name: KIAA1100
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034928: 75%, ENSRNOG00000028892: 38%
Entrez Gene ID: 22838
Uniprot ID: Q7L0R7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MRPWALAVTRWPPSAPVGQRRFSAGPGSTPGQLWGSPGLEGPLASPPARDERLPSQQPPSRPPHLPVEERRASAPAGGSPRMLHPATQ |
| Gene Sequence | MRPWALAVTRWPPSAPVGQRRFSAGPGSTPGQLWGSPGLEGPLASPPARDERLPSQQPPSRPPHLPVEERRASAPAGGSPRMLHPATQ |
| Gene ID - Mouse | ENSMUSG00000034928 |
| Gene ID - Rat | ENSRNOG00000028892 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RNF44 pAb (ATL-HPA038981) | |
| Datasheet | Anti RNF44 pAb (ATL-HPA038981) Datasheet (External Link) |
| Vendor Page | Anti RNF44 pAb (ATL-HPA038981) at Atlas Antibodies |
| Documents & Links for Anti RNF44 pAb (ATL-HPA038981) | |
| Datasheet | Anti RNF44 pAb (ATL-HPA038981) Datasheet (External Link) |
| Vendor Page | Anti RNF44 pAb (ATL-HPA038981) |