Anti RNF43 pAb (ATL-HPA008079)

Atlas Antibodies

Catalog No.: ATL-HPA008079-25

Protein Description: ring finger protein 43
Gene Name: RNF43
Alternative Gene Name: DKFZp781H0392, FLJ20315, URCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034177: 78%, ENSRNOG00000007606: 79%
Entrez Gene ID: 54894
Uniprot ID: Q68DV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CVDPWLHQHRTCPLCMFNITEGDSFSQSLGPSRSYQEPGRRLHLIRQHPGHAHYHLPAAYLLGPSRSAVARPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQQRLAGAQHPYAQGWGLSHLQSTSQH
• Gene Sequence: CVDPWLHQHRTCPLCMFNITEGDSFSQSLGPSRSYQEPGRRLHLIRQHPGHAHYHLPAAYLLGPSRSAVARPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQQRLAGAQHPYAQGWGLSHLQSTSQH
• Gene ID - Mouse: ENSMUSG00000034177
• Gene ID - Rat: ENSRNOG00000007606
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RNF43 pAb (ATL-HPA008079) – 5 Found

Xie, Haiyang; Xing, Chunyang; Cao, Guoqiang; Wei, Bajin; Xu, Xiao; Song, Penghong; Chen, Leiming; Chen, Hai; Yin, Shengyong; Zhou, Lin; Zheng, Shusen. Association of RNF43 with cell cycle proteins involved in p53 pathway. International Journal Of Clinical And Experimental Pathology. 8(11):14995-5000. 

Chan, Siu Chiu; Zhang, Ying; Pontoglio, Marco; Igarashi, Peter. Hepatocyte nuclear factor-1β regulates Wnt signaling through genome-wide competition with β-catenin/lymphoid enhancer binding factor. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2019;116(48):24133-24142. 

Tachibana, Shion; Mizukami, Yusuke; Ono, Yusuke; Sugiyama, Yuya; Okada, Tetsuhiro; Kitazaki, Arisa; Sasajima, Junpei; Tominaga, Motoya; Sakamoto, Jun; Kimura, Keisuke; Omori, Yuko; Furukawa, Toru; Kimura, Taichi; Tanaka, Shinya; Nagashima, Kazuo; Karasaki, Hidenori; Ohta, Tomoyuki; Okumura, Toshikatsu. Genetic Tracing of Clonal Expansion and Progression of Pancreatic Ductal Adenocarcinoma: A Case Report and Multi-Region Sequencing Analysis. Frontiers In Oncology. 10( 32582528):728. 

Neumeyer, Victoria; Brutau-Abia, Anna; Allgäuer, Michael; Pfarr, Nicole; Weichert, Wilko; Falkeis-Veits, Christina; Kremmer, Elisabeth; Vieth, Michael; Gerhard, Markus; Mejías-Luque, Raquel. Loss of RNF43 Function Contributes to Gastric Carcinogenesis by Impairing DNA Damage Response. Cellular And Molecular Gastroenterology And Hepatology. 11(4):1071-1094. 

Pangestu, Norma Sainstika; Chueakwon, Piyasiri; Talabnin, Krajang; Khiaowichit, Juthamas; Talabnin, Chutima. RNF43 overexpression attenuates the Wnt/β-catenin signalling pathway to suppress tumour progression in cholangiocarcinoma. Oncology Letters. 2021;22(6):846.