Anti RNF41 pAb (ATL-HPA016812)

Atlas Antibodies

Catalog No.: ATL-HPA016812-25

Protein Description: ring finger protein 41, E3 ubiquitin protein ligase
Gene Name: RNF41
Alternative Gene Name: NRDP1, SBBI03
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025373: 100%, ENSRNOG00000023456: 100%
Entrez Gene ID: 10193
Uniprot ID: Q9H4P4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRIPGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI
• Gene Sequence: DAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRIPGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI
• Gene ID - Mouse: ENSMUSG00000025373
• Gene ID - Rat: ENSRNOG00000023456
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RNF41 pAb (ATL-HPA016812) – 1 Found

Tullett, Kirsteen M; Tan, Peck Szee; Park, Hae-Young; Schittenhelm, Ralf B; Michael, Nicole; Li, Rong; Policheni, Antonia N; Gruber, Emily; Huang, Cheng; Fulcher, Alex J; Danne, Jillian C; Czabotar, Peter E; Wakim, Linda M; Mintern, Justine D; Ramm, Georg; Radford, Kristen J; Caminschi, Irina; O'Keeffe, Meredith; Villadangos, Jose A; Wright, Mark D; Blewitt, Marnie E; Heath, William R; Shortman, Ken; Purcell, Anthony W; Nicola, Nicos A; Zhang, Jian-Guo; Lahoud, Mireille H. RNF41 regulates the damage recognition receptor Clec9A and antigen cross-presentation in mouse dendritic cells. Elife. 2020;9( 33264090)