Anti RNF40 pAb (ATL-HPA054227)

Atlas Antibodies

SKU:
ATL-HPA054227-25
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ring finger protein 40, E3 ubiquitin protein ligase
Gene Name: RNF40
Alternative Gene Name: BRE1B, KIAA0661, RBP95, STARING
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030816: 75%, ENSRNOG00000018840: 75%
Entrez Gene ID: 9810
Uniprot ID: O75150
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTTTTTTSVKKEELVPSEEDFQGITPGAQGPSSRGREPEARPKRELREREGPSLGPP
Gene Sequence GTTTTTTSVKKEELVPSEEDFQGITPGAQGPSSRGREPEARPKRELREREGPSLGPP
Gene ID - Mouse ENSMUSG00000030816
Gene ID - Rat ENSRNOG00000018840
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RNF40 pAb (ATL-HPA054227)
Datasheet Anti RNF40 pAb (ATL-HPA054227) Datasheet (External Link)
Vendor Page Anti RNF40 pAb (ATL-HPA054227) at Atlas Antibodies

Documents & Links for Anti RNF40 pAb (ATL-HPA054227)
Datasheet Anti RNF40 pAb (ATL-HPA054227) Datasheet (External Link)
Vendor Page Anti RNF40 pAb (ATL-HPA054227)