Anti RNF40 pAb (ATL-HPA054227)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054227-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RNF40
Alternative Gene Name: BRE1B, KIAA0661, RBP95, STARING
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030816: 75%, ENSRNOG00000018840: 75%
Entrez Gene ID: 9810
Uniprot ID: O75150
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GTTTTTTSVKKEELVPSEEDFQGITPGAQGPSSRGREPEARPKRELREREGPSLGPP |
Gene Sequence | GTTTTTTSVKKEELVPSEEDFQGITPGAQGPSSRGREPEARPKRELREREGPSLGPP |
Gene ID - Mouse | ENSMUSG00000030816 |
Gene ID - Rat | ENSRNOG00000018840 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RNF40 pAb (ATL-HPA054227) | |
Datasheet | Anti RNF40 pAb (ATL-HPA054227) Datasheet (External Link) |
Vendor Page | Anti RNF40 pAb (ATL-HPA054227) at Atlas Antibodies |
Documents & Links for Anti RNF40 pAb (ATL-HPA054227) | |
Datasheet | Anti RNF40 pAb (ATL-HPA054227) Datasheet (External Link) |
Vendor Page | Anti RNF40 pAb (ATL-HPA054227) |