Anti RNF40 pAb (ATL-HPA054227)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054227-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RNF40
Alternative Gene Name: BRE1B, KIAA0661, RBP95, STARING
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030816: 75%, ENSRNOG00000018840: 75%
Entrez Gene ID: 9810
Uniprot ID: O75150
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GTTTTTTSVKKEELVPSEEDFQGITPGAQGPSSRGREPEARPKRELREREGPSLGPP |
| Gene Sequence | GTTTTTTSVKKEELVPSEEDFQGITPGAQGPSSRGREPEARPKRELREREGPSLGPP |
| Gene ID - Mouse | ENSMUSG00000030816 |
| Gene ID - Rat | ENSRNOG00000018840 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RNF40 pAb (ATL-HPA054227) | |
| Datasheet | Anti RNF40 pAb (ATL-HPA054227) Datasheet (External Link) |
| Vendor Page | Anti RNF40 pAb (ATL-HPA054227) at Atlas Antibodies |
| Documents & Links for Anti RNF40 pAb (ATL-HPA054227) | |
| Datasheet | Anti RNF40 pAb (ATL-HPA054227) Datasheet (External Link) |
| Vendor Page | Anti RNF40 pAb (ATL-HPA054227) |