Anti RNF34 pAb (ATL-HPA074151)

Atlas Antibodies

Catalog No.:
ATL-HPA074151-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ring finger protein 34, E3 ubiquitin protein ligase
Gene Name: RNF34
Alternative Gene Name: FLJ21786, RIF, RIFF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029474: 97%, ENSRNOG00000001331: 97%
Entrez Gene ID: 80196
Uniprot ID: Q969K3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDL
Gene Sequence NIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDL
Gene ID - Mouse ENSMUSG00000029474
Gene ID - Rat ENSRNOG00000001331
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF34 pAb (ATL-HPA074151)
Datasheet Anti RNF34 pAb (ATL-HPA074151) Datasheet (External Link)
Vendor Page Anti RNF34 pAb (ATL-HPA074151) at Atlas Antibodies

Documents & Links for Anti RNF34 pAb (ATL-HPA074151)
Datasheet Anti RNF34 pAb (ATL-HPA074151) Datasheet (External Link)
Vendor Page Anti RNF34 pAb (ATL-HPA074151)