Anti RNF220 pAb (ATL-HPA027578)

Atlas Antibodies

Catalog No.: ATL-HPA027578-25

Protein Description: ring finger protein 220
Gene Name: RNF220
Alternative Gene Name: C1orf164, FLJ10597
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028677: 100%, ENSRNOG00000005609: 27%
Entrez Gene ID: 55182
Uniprot ID: Q5VTB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPRPFGVPVSVDKDVHIPFTNGSYTFASMYHRQGGVPGTFANRDFPPSLLHLHPQFAPPNLDCTPISMLNHSGVGAFRPFASTEDRESYQSAFTPAKRLKNC
• Gene Sequence: QPRPFGVPVSVDKDVHIPFTNGSYTFASMYHRQGGVPGTFANRDFPPSLLHLHPQFAPPNLDCTPISMLNHSGVGAFRPFASTEDRESYQSAFTPAKRLKNC
• Gene ID - Mouse: ENSMUSG00000028677
• Gene ID - Rat: ENSRNOG00000005609
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RNF220 pAb (ATL-HPA027578) – 3 Found

Ma, Pengcheng; Li, Yuwei; Wang, Huishan; Mao, Bingyu. Haploinsufficiency of the TDP43 ubiquitin E3 ligase RNF220 leads to ALS-like motor neuron defects in the mouse. Journal Of Molecular Cell Biology. 2021;13(5):374-382. 

Zhang, Longlong; Ye, Maosen; Zhu, Liang; Cha, Jingmei; Li, Chaocui; Yao, Yong-Gang; Mao, Bingyu. Loss of ZC4H2 and RNF220 Inhibits Neural Stem Cell Proliferation and Promotes Neuronal Differentiation. Cells. 2020;9(7) 

Ma, Pengcheng; Wan, Li Pear; Li, Yuwei; He, Chun-Hui; Song, Ning-Ning; Zhao, Shiping; Wang, Huishan; Ding, Yu-Qiang; Mao, Bingyu; Sheng, Nengyin. RNF220 is an E3 ubiquitin ligase for AMPA receptors to regulate synaptic transmission. Science Advances. 2022;8(39):eabq4736.