Anti RNF215 pAb (ATL-HPA056498)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056498-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RNF215
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003581: 94%, ENSRNOG00000004940: 95%
Entrez Gene ID: 200312
Uniprot ID: Q9Y6U7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LDISQLLLRPVIVLHYSSNVTKLLDALLQRTQATAEITSGESLSANIEWKLTLWTTCGLSKDGYGGWQDLVCLGGSRAQEQKP |
Gene Sequence | LDISQLLLRPVIVLHYSSNVTKLLDALLQRTQATAEITSGESLSANIEWKLTLWTTCGLSKDGYGGWQDLVCLGGSRAQEQKP |
Gene ID - Mouse | ENSMUSG00000003581 |
Gene ID - Rat | ENSRNOG00000004940 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RNF215 pAb (ATL-HPA056498) | |
Datasheet | Anti RNF215 pAb (ATL-HPA056498) Datasheet (External Link) |
Vendor Page | Anti RNF215 pAb (ATL-HPA056498) at Atlas Antibodies |
Documents & Links for Anti RNF215 pAb (ATL-HPA056498) | |
Datasheet | Anti RNF215 pAb (ATL-HPA056498) Datasheet (External Link) |
Vendor Page | Anti RNF215 pAb (ATL-HPA056498) |