Anti RNF215 pAb (ATL-HPA056498)

Atlas Antibodies

Catalog No.:
ATL-HPA056498-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ring finger protein 215
Gene Name: RNF215
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003581: 94%, ENSRNOG00000004940: 95%
Entrez Gene ID: 200312
Uniprot ID: Q9Y6U7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDISQLLLRPVIVLHYSSNVTKLLDALLQRTQATAEITSGESLSANIEWKLTLWTTCGLSKDGYGGWQDLVCLGGSRAQEQKP
Gene Sequence LDISQLLLRPVIVLHYSSNVTKLLDALLQRTQATAEITSGESLSANIEWKLTLWTTCGLSKDGYGGWQDLVCLGGSRAQEQKP
Gene ID - Mouse ENSMUSG00000003581
Gene ID - Rat ENSRNOG00000004940
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF215 pAb (ATL-HPA056498)
Datasheet Anti RNF215 pAb (ATL-HPA056498) Datasheet (External Link)
Vendor Page Anti RNF215 pAb (ATL-HPA056498) at Atlas Antibodies

Documents & Links for Anti RNF215 pAb (ATL-HPA056498)
Datasheet Anti RNF215 pAb (ATL-HPA056498) Datasheet (External Link)
Vendor Page Anti RNF215 pAb (ATL-HPA056498)