Anti RNF215 pAb (ATL-HPA056498)
Atlas Antibodies
- Catalog No.:
 - ATL-HPA056498-25
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $447.00
    
         
                            Gene Name: RNF215
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003581: 94%, ENSRNOG00000004940: 95%
Entrez Gene ID: 200312
Uniprot ID: Q9Y6U7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | LDISQLLLRPVIVLHYSSNVTKLLDALLQRTQATAEITSGESLSANIEWKLTLWTTCGLSKDGYGGWQDLVCLGGSRAQEQKP | 
| Gene Sequence | LDISQLLLRPVIVLHYSSNVTKLLDALLQRTQATAEITSGESLSANIEWKLTLWTTCGLSKDGYGGWQDLVCLGGSRAQEQKP | 
| Gene ID - Mouse | ENSMUSG00000003581 | 
| Gene ID - Rat | ENSRNOG00000004940 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti RNF215 pAb (ATL-HPA056498) | |
| Datasheet | Anti RNF215 pAb (ATL-HPA056498) Datasheet (External Link) | 
| Vendor Page | Anti RNF215 pAb (ATL-HPA056498) at Atlas Antibodies | 
| Documents & Links for Anti RNF215 pAb (ATL-HPA056498) | |
| Datasheet | Anti RNF215 pAb (ATL-HPA056498) Datasheet (External Link) | 
| Vendor Page | Anti RNF215 pAb (ATL-HPA056498) |