Anti RNF208 pAb (ATL-HPA021256)

Atlas Antibodies

Catalog No.: ATL-HPA021256-25

Protein Description: ring finger protein 208
Gene Name: RNF208
Alternative Gene Name: DKFZP761H1710
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044628: 89%, ENSRNOG00000010607: 89%
Entrez Gene ID: 727800
Uniprot ID: Q9H0X6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGAPHTPPLPRRPRKGSSELGFPRVAPEDEVIVNQYVIRPGPSASAASSAAAGEPLECPTCGHSYNVTQRRPRVLSCLHSVCEQC
• Gene Sequence: EGAPHTPPLPRRPRKGSSELGFPRVAPEDEVIVNQYVIRPGPSASAASSAAAGEPLECPTCGHSYNVTQRRPRVLSCLHSVCEQC
• Gene ID - Mouse: ENSMUSG00000044628
• Gene ID - Rat: ENSRNOG00000010607
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.