Anti RNF207 pAb (ATL-HPA028378)

Atlas Antibodies

Catalog No.: ATL-HPA028378-25

Protein Description: ring finger protein 207
Gene Name: RNF207
Alternative Gene Name: C1orf188, FLJ32096, FLJ46380
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058498: 43%, ENSRNOG00000033722: 46%
Entrez Gene ID: 388591
Uniprot ID: Q6ZRF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVDEQSESLQNTHDDSRNNAASARNNPGSVPEKREKTSEPKGNSWAPNGLSEEPLLKNMDHHRSKQKNGGDVPTWREHP
• Gene Sequence: PVDEQSESLQNTHDDSRNNAASARNNPGSVPEKREKTSEPKGNSWAPNGLSEEPLLKNMDHHRSKQKNGGDVPTWREHP
• Gene ID - Mouse: ENSMUSG00000058498
• Gene ID - Rat: ENSRNOG00000033722
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.