Anti RNF20 pAb (ATL-HPA051773)

Atlas Antibodies

Catalog No.:
ATL-HPA051773-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ring finger protein 20, E3 ubiquitin protein ligase
Gene Name: RNF20
Alternative Gene Name: BRE1, BRE1A, FLJ11189, FLJ20382, hBRE1, KAIA2779
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028309: 97%, ENSRNOG00000006087: 99%
Entrez Gene ID: 56254
Uniprot ID: Q5VTR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVNRYWSQFDENIRIILKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFSFLATLAS
Gene Sequence IVNRYWSQFDENIRIILKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFSFLATLAS
Gene ID - Mouse ENSMUSG00000028309
Gene ID - Rat ENSRNOG00000006087
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF20 pAb (ATL-HPA051773)
Datasheet Anti RNF20 pAb (ATL-HPA051773) Datasheet (External Link)
Vendor Page Anti RNF20 pAb (ATL-HPA051773) at Atlas Antibodies

Documents & Links for Anti RNF20 pAb (ATL-HPA051773)
Datasheet Anti RNF20 pAb (ATL-HPA051773) Datasheet (External Link)
Vendor Page Anti RNF20 pAb (ATL-HPA051773)