Anti RNF19B pAb (ATL-HPA063640)

Atlas Antibodies

Catalog No.:
ATL-HPA063640-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ring finger protein 19B
Gene Name: RNF19B
Alternative Gene Name: FLJ90005, IBRDC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028793: 96%, ENSRNOG00000000123: 98%
Entrez Gene ID: 127544
Uniprot ID: Q6ZMZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSIISSYNPQDRECNNMEIQVDIEAKPSHYQLVSGSSTEDSLHVHAQMAENEEEG
Gene Sequence GSIISSYNPQDRECNNMEIQVDIEAKPSHYQLVSGSSTEDSLHVHAQMAENEEEG
Gene ID - Mouse ENSMUSG00000028793
Gene ID - Rat ENSRNOG00000000123
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF19B pAb (ATL-HPA063640)
Datasheet Anti RNF19B pAb (ATL-HPA063640) Datasheet (External Link)
Vendor Page Anti RNF19B pAb (ATL-HPA063640) at Atlas Antibodies

Documents & Links for Anti RNF19B pAb (ATL-HPA063640)
Datasheet Anti RNF19B pAb (ATL-HPA063640) Datasheet (External Link)
Vendor Page Anti RNF19B pAb (ATL-HPA063640)