Anti RNF19B pAb (ATL-HPA049587)

Atlas Antibodies

Catalog No.: ATL-HPA049587-25

Protein Description: ring finger protein 19B
Gene Name: RNF19B
Alternative Gene Name: FLJ90005, IBRDC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028793: 82%, ENSRNOG00000000123: 84%
Entrez Gene ID: 127544
Uniprot ID: Q6ZMZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQPESIRSDLESSDAQSDDVPDITSDECGSPRSHTAACPSTPRAQGAPSPSAHMNLSALAEGQTVLKPEGGEA
• Gene Sequence: AQPESIRSDLESSDAQSDDVPDITSDECGSPRSHTAACPSTPRAQGAPSPSAHMNLSALAEGQTVLKPEGGEA
• Gene ID - Mouse: ENSMUSG00000028793
• Gene ID - Rat: ENSRNOG00000000123
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.