Anti RNF187 pAb (ATL-HPA030098)

Atlas Antibodies

Catalog No.: ATL-HPA030098-25

Protein Description: ring finger protein 187
Gene Name: RNF187
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020496: 92%, ENSRNOG00000049219: 91%
Entrez Gene ID: 149603
Uniprot ID: Q5TA31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDELADPTERFRSLLQAVSELEKKHRNLGLSMLLQ
• Gene Sequence: HVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDELADPTERFRSLLQAVSELEKKHRNLGLSMLLQ
• Gene ID - Mouse: ENSMUSG00000020496
• Gene ID - Rat: ENSRNOG00000049219
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RNF187 pAb (ATL-HPA030098) – 2 Found

Chakraborty, Atanu; Diefenbacher, Markus E; Mylona, Anastasia; Kassel, Olivier; Behrens, Axel. The E3 ubiquitin ligase Trim7 mediates c-Jun/AP-1 activation by Ras signalling. Nature Communications. 2015;6( 25851810):6782. 

Li, Xin; Niu, Zhiguo; Sun, Chen; Zhuo, Shu; Yang, Huijie; Yang, Xiao; Liu, Yun; Yan, Cheng; Li, Zhongbo; Cao, Qi; Ji, Guimei; Ding, Yinlu; Zhuang, Ting; Zhu, Jian. Regulation of P53 signaling in breast cancer by the E3 ubiquitin ligase RNF187. Cell Death & Disease. 2022;13(2):149.