Anti RNF183 pAb (ATL-HPA057675)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057675-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RNF183
Alternative Gene Name: MGC4734
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063851: 97%, ENSRNOG00000014861: 94%
Entrez Gene ID: 138065
Uniprot ID: Q96D59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTD |
Gene Sequence | ELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTD |
Gene ID - Mouse | ENSMUSG00000063851 |
Gene ID - Rat | ENSRNOG00000014861 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RNF183 pAb (ATL-HPA057675) | |
Datasheet | Anti RNF183 pAb (ATL-HPA057675) Datasheet (External Link) |
Vendor Page | Anti RNF183 pAb (ATL-HPA057675) at Atlas Antibodies |
Documents & Links for Anti RNF183 pAb (ATL-HPA057675) | |
Datasheet | Anti RNF183 pAb (ATL-HPA057675) Datasheet (External Link) |
Vendor Page | Anti RNF183 pAb (ATL-HPA057675) |