Anti RNF183 pAb (ATL-HPA057675)

Atlas Antibodies

Catalog No.:
ATL-HPA057675-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ring finger protein 183
Gene Name: RNF183
Alternative Gene Name: MGC4734
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063851: 97%, ENSRNOG00000014861: 94%
Entrez Gene ID: 138065
Uniprot ID: Q96D59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTD
Gene Sequence ELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTD
Gene ID - Mouse ENSMUSG00000063851
Gene ID - Rat ENSRNOG00000014861
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF183 pAb (ATL-HPA057675)
Datasheet Anti RNF183 pAb (ATL-HPA057675) Datasheet (External Link)
Vendor Page Anti RNF183 pAb (ATL-HPA057675) at Atlas Antibodies

Documents & Links for Anti RNF183 pAb (ATL-HPA057675)
Datasheet Anti RNF183 pAb (ATL-HPA057675) Datasheet (External Link)
Vendor Page Anti RNF183 pAb (ATL-HPA057675)