Anti RNF183 pAb (ATL-HPA057675)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057675-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RNF183
Alternative Gene Name: MGC4734
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063851: 97%, ENSRNOG00000014861: 94%
Entrez Gene ID: 138065
Uniprot ID: Q96D59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTD |
| Gene Sequence | ELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTD |
| Gene ID - Mouse | ENSMUSG00000063851 |
| Gene ID - Rat | ENSRNOG00000014861 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RNF183 pAb (ATL-HPA057675) | |
| Datasheet | Anti RNF183 pAb (ATL-HPA057675) Datasheet (External Link) |
| Vendor Page | Anti RNF183 pAb (ATL-HPA057675) at Atlas Antibodies |
| Documents & Links for Anti RNF183 pAb (ATL-HPA057675) | |
| Datasheet | Anti RNF183 pAb (ATL-HPA057675) Datasheet (External Link) |
| Vendor Page | Anti RNF183 pAb (ATL-HPA057675) |