Anti RNF170 pAb (ATL-HPA054621)

Atlas Antibodies

SKU: ATL-HPA054621-25

• 

Protein Description: ring finger protein 170
Gene Name: RNF170
Alternative Gene Name: ADSA, DKFZP564A022, SNAX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013878: 89%, ENSRNOG00000045943: 91%
Entrez Gene ID: 81790
Uniprot ID: Q96K19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETN
• Gene Sequence: ENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETN
• Gene ID - Mouse: ENSMUSG00000013878
• Gene ID - Rat: ENSRNOG00000045943
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RNF170 pAb (ATL-HPA054621) – 2 Found

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. 

Wagner, Matias; Osborn, Daniel P S; Gehweiler, Ina; Nagel, Maike; Ulmer, Ulrike; Bakhtiari, Somayeh; Amouri, Rim; Boostani, Reza; Hentati, Faycal; Hockley, Maryam M; Hölbling, Benedikt; Schwarzmayr, Thomas; Karimiani, Ehsan Ghayoor; Kernstock, Christoph; Maroofian, Reza; Müller-Felber, Wolfgang; Ozkan, Ege; Padilla-Lopez, Sergio; Reich, Selina; Reichbauer, Jennifer; Darvish, Hossein; Shahmohammadibeni, Neda; Tafakhori, Abbas; Vill, Katharina; Zuchner, Stephan; Kruer, Michael C; Winkelmann, Juliane; Jamshidi, Yalda; Schüle, Rebecca. Bi-allelic variants in RNF170 are associated with hereditary spastic paraplegia. Nature Communications. 2019;10(1):4790.