Anti RNF157 pAb (ATL-HPA021854)

Atlas Antibodies

Catalog No.:
ATL-HPA021854-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ring finger protein 157
Gene Name: RNF157
Alternative Gene Name: KIAA1917
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052949: 78%, ENSRNOG00000049862: 78%
Entrez Gene ID: 114804
Uniprot ID: Q96PX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEEDGSPTQEGQRTCAFLGMECDNNNDFDIASVKALDNKLCSEVCLPGAWQADDNAVSRNAQ
Gene Sequence EEEDGSPTQEGQRTCAFLGMECDNNNDFDIASVKALDNKLCSEVCLPGAWQADDNAVSRNAQ
Gene ID - Mouse ENSMUSG00000052949
Gene ID - Rat ENSRNOG00000049862
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF157 pAb (ATL-HPA021854)
Datasheet Anti RNF157 pAb (ATL-HPA021854) Datasheet (External Link)
Vendor Page Anti RNF157 pAb (ATL-HPA021854) at Atlas Antibodies

Documents & Links for Anti RNF157 pAb (ATL-HPA021854)
Datasheet Anti RNF157 pAb (ATL-HPA021854) Datasheet (External Link)
Vendor Page Anti RNF157 pAb (ATL-HPA021854)