Anti RNF150 pAb (ATL-HPA037987)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037987-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RNF150
Alternative Gene Name: KIAA1214
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047747: 93%, ENSRNOG00000003479: 93%
Entrez Gene ID: 57484
Uniprot ID: Q9ULK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AELHTEKTECGRYGEHSPKQDARGEVVMASSAHDRLACDPNTKFAAPTRGKNWIALIPKGNCTYRDKI |
| Gene Sequence | AELHTEKTECGRYGEHSPKQDARGEVVMASSAHDRLACDPNTKFAAPTRGKNWIALIPKGNCTYRDKI |
| Gene ID - Mouse | ENSMUSG00000047747 |
| Gene ID - Rat | ENSRNOG00000003479 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RNF150 pAb (ATL-HPA037987) | |
| Datasheet | Anti RNF150 pAb (ATL-HPA037987) Datasheet (External Link) |
| Vendor Page | Anti RNF150 pAb (ATL-HPA037987) at Atlas Antibodies |
| Documents & Links for Anti RNF150 pAb (ATL-HPA037987) | |
| Datasheet | Anti RNF150 pAb (ATL-HPA037987) Datasheet (External Link) |
| Vendor Page | Anti RNF150 pAb (ATL-HPA037987) |