Anti RNF150 pAb (ATL-HPA037987)

Atlas Antibodies

Catalog No.:
ATL-HPA037987-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ring finger protein 150
Gene Name: RNF150
Alternative Gene Name: KIAA1214
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047747: 93%, ENSRNOG00000003479: 93%
Entrez Gene ID: 57484
Uniprot ID: Q9ULK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AELHTEKTECGRYGEHSPKQDARGEVVMASSAHDRLACDPNTKFAAPTRGKNWIALIPKGNCTYRDKI
Gene Sequence AELHTEKTECGRYGEHSPKQDARGEVVMASSAHDRLACDPNTKFAAPTRGKNWIALIPKGNCTYRDKI
Gene ID - Mouse ENSMUSG00000047747
Gene ID - Rat ENSRNOG00000003479
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF150 pAb (ATL-HPA037987)
Datasheet Anti RNF150 pAb (ATL-HPA037987) Datasheet (External Link)
Vendor Page Anti RNF150 pAb (ATL-HPA037987) at Atlas Antibodies

Documents & Links for Anti RNF150 pAb (ATL-HPA037987)
Datasheet Anti RNF150 pAb (ATL-HPA037987) Datasheet (External Link)
Vendor Page Anti RNF150 pAb (ATL-HPA037987)