Anti RNF144B pAb (ATL-HPA054127)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054127-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RNF144B
Alternative Gene Name: bA528A10.3, IBRDC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038068: 77%, ENSRNOG00000016123: 77%
Entrez Gene ID: 255488
Uniprot ID: Q7Z419
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIF |
Gene Sequence | MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIF |
Gene ID - Mouse | ENSMUSG00000038068 |
Gene ID - Rat | ENSRNOG00000016123 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RNF144B pAb (ATL-HPA054127) | |
Datasheet | Anti RNF144B pAb (ATL-HPA054127) Datasheet (External Link) |
Vendor Page | Anti RNF144B pAb (ATL-HPA054127) at Atlas Antibodies |
Documents & Links for Anti RNF144B pAb (ATL-HPA054127) | |
Datasheet | Anti RNF144B pAb (ATL-HPA054127) Datasheet (External Link) |
Vendor Page | Anti RNF144B pAb (ATL-HPA054127) |