Anti RNF144B pAb (ATL-HPA054127)

Atlas Antibodies

Catalog No.:
ATL-HPA054127-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ring finger protein 144B
Gene Name: RNF144B
Alternative Gene Name: bA528A10.3, IBRDC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038068: 77%, ENSRNOG00000016123: 77%
Entrez Gene ID: 255488
Uniprot ID: Q7Z419
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIF
Gene Sequence MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIF
Gene ID - Mouse ENSMUSG00000038068
Gene ID - Rat ENSRNOG00000016123
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF144B pAb (ATL-HPA054127)
Datasheet Anti RNF144B pAb (ATL-HPA054127) Datasheet (External Link)
Vendor Page Anti RNF144B pAb (ATL-HPA054127) at Atlas Antibodies

Documents & Links for Anti RNF144B pAb (ATL-HPA054127)
Datasheet Anti RNF144B pAb (ATL-HPA054127) Datasheet (External Link)
Vendor Page Anti RNF144B pAb (ATL-HPA054127)