Anti RNF144A pAb (ATL-HPA049939)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049939-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RNF144A
Alternative Gene Name: KIAA0161, RNF144, UBCE7IP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020642: 100%, ENSRNOG00000007370: 100%
Entrez Gene ID: 9781
Uniprot ID: P50876
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVC |
Gene Sequence | CTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVC |
Gene ID - Mouse | ENSMUSG00000020642 |
Gene ID - Rat | ENSRNOG00000007370 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RNF144A pAb (ATL-HPA049939) | |
Datasheet | Anti RNF144A pAb (ATL-HPA049939) Datasheet (External Link) |
Vendor Page | Anti RNF144A pAb (ATL-HPA049939) at Atlas Antibodies |
Documents & Links for Anti RNF144A pAb (ATL-HPA049939) | |
Datasheet | Anti RNF144A pAb (ATL-HPA049939) Datasheet (External Link) |
Vendor Page | Anti RNF144A pAb (ATL-HPA049939) |