Anti RNF144A pAb (ATL-HPA049939)

Atlas Antibodies

Catalog No.:
ATL-HPA049939-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ring finger protein 144A
Gene Name: RNF144A
Alternative Gene Name: KIAA0161, RNF144, UBCE7IP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020642: 100%, ENSRNOG00000007370: 100%
Entrez Gene ID: 9781
Uniprot ID: P50876
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVC
Gene Sequence CTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVC
Gene ID - Mouse ENSMUSG00000020642
Gene ID - Rat ENSRNOG00000007370
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF144A pAb (ATL-HPA049939)
Datasheet Anti RNF144A pAb (ATL-HPA049939) Datasheet (External Link)
Vendor Page Anti RNF144A pAb (ATL-HPA049939) at Atlas Antibodies

Documents & Links for Anti RNF144A pAb (ATL-HPA049939)
Datasheet Anti RNF144A pAb (ATL-HPA049939) Datasheet (External Link)
Vendor Page Anti RNF144A pAb (ATL-HPA049939)