Anti RNF141 pAb (ATL-HPA018133 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018133-25

Protein Description: ring finger protein 141
Gene Name: RNF141
Alternative Gene Name: ZFP26, ZNF230
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030788: 99%, ENSRNOG00000017900: 97%
Entrez Gene ID: 50862
Uniprot ID: Q8WVD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHLLFEVQPGSDSSAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQASLWMGRVKQLTDE
• Gene Sequence: QLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHLLFEVQPGSDSSAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQASLWMGRVKQLTDE
• Gene ID - Mouse: ENSMUSG00000030788
• Gene ID - Rat: ENSRNOG00000017900
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.