Anti RNF14 pAb (ATL-HPA064746)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064746-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RNF14
Alternative Gene Name: ARA54, HFB30, TRIAD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060450: 88%, ENSRNOG00000045637: 85%
Entrez Gene ID: 9604
Uniprot ID: Q9UBS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNL |
| Gene Sequence | TQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNL |
| Gene ID - Mouse | ENSMUSG00000060450 |
| Gene ID - Rat | ENSRNOG00000045637 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RNF14 pAb (ATL-HPA064746) | |
| Datasheet | Anti RNF14 pAb (ATL-HPA064746) Datasheet (External Link) |
| Vendor Page | Anti RNF14 pAb (ATL-HPA064746) at Atlas Antibodies |
| Documents & Links for Anti RNF14 pAb (ATL-HPA064746) | |
| Datasheet | Anti RNF14 pAb (ATL-HPA064746) Datasheet (External Link) |
| Vendor Page | Anti RNF14 pAb (ATL-HPA064746) |