Anti RNF135 pAb (ATL-HPA052404)
Atlas Antibodies
- SKU:
- ATL-HPA052404-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RNF135
Alternative Gene Name: MGC13061
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020707: 64%, ENSRNOG00000004093: 66%
Entrez Gene ID: 84282
Uniprot ID: Q8IUD6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLHPGNYLIIKQVKV |
Gene Sequence | GTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLHPGNYLIIKQVKV |
Gene ID - Mouse | ENSMUSG00000020707 |
Gene ID - Rat | ENSRNOG00000004093 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RNF135 pAb (ATL-HPA052404) | |
Datasheet | Anti RNF135 pAb (ATL-HPA052404) Datasheet (External Link) |
Vendor Page | Anti RNF135 pAb (ATL-HPA052404) at Atlas Antibodies |
Documents & Links for Anti RNF135 pAb (ATL-HPA052404) | |
Datasheet | Anti RNF135 pAb (ATL-HPA052404) Datasheet (External Link) |
Vendor Page | Anti RNF135 pAb (ATL-HPA052404) |