Anti RNF135 pAb (ATL-HPA052404)

Atlas Antibodies

SKU:
ATL-HPA052404-25
  • Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ring finger protein 135
Gene Name: RNF135
Alternative Gene Name: MGC13061
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020707: 64%, ENSRNOG00000004093: 66%
Entrez Gene ID: 84282
Uniprot ID: Q8IUD6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLHPGNYLIIKQVKV
Gene Sequence GTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLHPGNYLIIKQVKV
Gene ID - Mouse ENSMUSG00000020707
Gene ID - Rat ENSRNOG00000004093
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RNF135 pAb (ATL-HPA052404)
Datasheet Anti RNF135 pAb (ATL-HPA052404) Datasheet (External Link)
Vendor Page Anti RNF135 pAb (ATL-HPA052404) at Atlas Antibodies

Documents & Links for Anti RNF135 pAb (ATL-HPA052404)
Datasheet Anti RNF135 pAb (ATL-HPA052404) Datasheet (External Link)
Vendor Page Anti RNF135 pAb (ATL-HPA052404)