Anti RNF135 pAb (ATL-HPA052404)

Atlas Antibodies

Catalog No.: ATL-HPA052404-25

Protein Description: ring finger protein 135
Gene Name: RNF135
Alternative Gene Name: MGC13061
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020707: 64%, ENSRNOG00000004093: 66%
Entrez Gene ID: 84282
Uniprot ID: Q8IUD6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLHPGNYLIIKQVKV
• Gene Sequence: GTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLHPGNYLIIKQVKV
• Gene ID - Mouse: ENSMUSG00000020707
• Gene ID - Rat: ENSRNOG00000004093
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.