Anti RNF13 pAb (ATL-HPA064784)

Atlas Antibodies

SKU: ATL-HPA064784-25

• 
• 
• 

Protein Description: ring finger protein 13
Gene Name: RNF13
Alternative Gene Name: RZF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036503: 97%, ENSRNOG00000029209: 97%
Entrez Gene ID: 11342
Uniprot ID: O43567
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NASQTFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPVKDNSSGTFIVLIRRLDC
• Gene Sequence: NASQTFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPVKDNSSGTFIVLIRRLDC
• Gene ID - Mouse: ENSMUSG00000036503
• Gene ID - Rat: ENSRNOG00000029209
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.