Anti RNF13 pAb (ATL-HPA064784)

Atlas Antibodies

Catalog No.:
ATL-HPA064784-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ring finger protein 13
Gene Name: RNF13
Alternative Gene Name: RZF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036503: 97%, ENSRNOG00000029209: 97%
Entrez Gene ID: 11342
Uniprot ID: O43567
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NASQTFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPVKDNSSGTFIVLIRRLDC
Gene Sequence NASQTFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPVKDNSSGTFIVLIRRLDC
Gene ID - Mouse ENSMUSG00000036503
Gene ID - Rat ENSRNOG00000029209
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF13 pAb (ATL-HPA064784)
Datasheet Anti RNF13 pAb (ATL-HPA064784) Datasheet (External Link)
Vendor Page Anti RNF13 pAb (ATL-HPA064784) at Atlas Antibodies

Documents & Links for Anti RNF13 pAb (ATL-HPA064784)
Datasheet Anti RNF13 pAb (ATL-HPA064784) Datasheet (External Link)
Vendor Page Anti RNF13 pAb (ATL-HPA064784)