Anti RNF123 pAb (ATL-HPA071879)

Atlas Antibodies

Catalog No.:
ATL-HPA071879-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ring finger protein 123
Gene Name: RNF123
Alternative Gene Name: FLJ12565
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041528: 95%, ENSRNOG00000033378: 93%
Entrez Gene ID: 63891
Uniprot ID: Q5XPI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSTSEKVKVRTLSVEQRTREDIEGSHWNEGLLLGRPPEEPEQPLTENSLLEVLDGAVMMYNLSVHQQLGKMVGVSDDVNEYAMA
Gene Sequence LSTSEKVKVRTLSVEQRTREDIEGSHWNEGLLLGRPPEEPEQPLTENSLLEVLDGAVMMYNLSVHQQLGKMVGVSDDVNEYAMA
Gene ID - Mouse ENSMUSG00000041528
Gene ID - Rat ENSRNOG00000033378
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF123 pAb (ATL-HPA071879)
Datasheet Anti RNF123 pAb (ATL-HPA071879) Datasheet (External Link)
Vendor Page Anti RNF123 pAb (ATL-HPA071879) at Atlas Antibodies

Documents & Links for Anti RNF123 pAb (ATL-HPA071879)
Datasheet Anti RNF123 pAb (ATL-HPA071879) Datasheet (External Link)
Vendor Page Anti RNF123 pAb (ATL-HPA071879)