Anti RNF113A pAb (ATL-HPA000160)

Atlas Antibodies

Catalog No.: ATL-HPA000160-25

Protein Description: ring finger protein 113A
Gene Name: RNF113A
Alternative Gene Name: Cwc24, RNF113, ZNF183
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098134: 90%, ENSRNOG00000059412: 86%
Entrez Gene ID: 7737
Uniprot ID: O15541
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYR
• Gene Sequence: GSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYR
• Gene ID - Mouse: ENSMUSG00000098134
• Gene ID - Rat: ENSRNOG00000059412
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RNF113A pAb (ATL-HPA000160) – 1 Found

Shostak, Kateryna; Jiang, Zheshen; Charloteaux, Benoit; Mayer, Alice; Habraken, Yvette; Tharun, Lars; Klein, Sebastian; Xu, Xinyi; Duong, Hong Quan; Vislovukh, Andrii; Close, Pierre; Florin, Alexandra; Rambow, Florian; Marine, Jean-Christophe; Büttner, Reinhard; Chariot, Alain. The X-linked trichothiodystrophy-causing gene RNF113A links the spliceosome to cell survival upon DNA damage. Nature Communications. 2020;11(1):1270.