Anti RND3 pAb (ATL-HPA060504)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060504-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RND3
Alternative Gene Name: ARHE, Rho8, RhoE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017144: 96%, ENSRNOG00000004624: 96%
Entrez Gene ID: 390
Uniprot ID: P61587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTVL |
Gene Sequence | SHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTVL |
Gene ID - Mouse | ENSMUSG00000017144 |
Gene ID - Rat | ENSRNOG00000004624 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RND3 pAb (ATL-HPA060504) | |
Datasheet | Anti RND3 pAb (ATL-HPA060504) Datasheet (External Link) |
Vendor Page | Anti RND3 pAb (ATL-HPA060504) at Atlas Antibodies |
Documents & Links for Anti RND3 pAb (ATL-HPA060504) | |
Datasheet | Anti RND3 pAb (ATL-HPA060504) Datasheet (External Link) |
Vendor Page | Anti RND3 pAb (ATL-HPA060504) |