Anti RND2 pAb (ATL-HPA077757)

Atlas Antibodies

SKU: ATL-HPA077757-25

• 

Protein Description: Rho family GTPase 2
Gene Name: RND2
Alternative Gene Name: ARHN, Rho7, RhoN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001313: 100%, ENSRNOG00000020698: 100%
Entrez Gene ID: 8153
Uniprot ID: P52198
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDV
• Gene Sequence: GCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDV
• Gene ID - Mouse: ENSMUSG00000001313
• Gene ID - Rat: ENSRNOG00000020698
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.