Anti RND2 pAb (ATL-HPA077757)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077757-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RND2
Alternative Gene Name: ARHN, Rho7, RhoN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001313: 100%, ENSRNOG00000020698: 100%
Entrez Gene ID: 8153
Uniprot ID: P52198
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDV |
| Gene Sequence | GCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDV |
| Gene ID - Mouse | ENSMUSG00000001313 |
| Gene ID - Rat | ENSRNOG00000020698 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RND2 pAb (ATL-HPA077757) | |
| Datasheet | Anti RND2 pAb (ATL-HPA077757) Datasheet (External Link) |
| Vendor Page | Anti RND2 pAb (ATL-HPA077757) at Atlas Antibodies |
| Documents & Links for Anti RND2 pAb (ATL-HPA077757) | |
| Datasheet | Anti RND2 pAb (ATL-HPA077757) Datasheet (External Link) |
| Vendor Page | Anti RND2 pAb (ATL-HPA077757) |