Anti RNASET2 pAb (ATL-HPA066509)

Atlas Antibodies

Catalog No.:
ATL-HPA066509-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ribonuclease T2
Gene Name: RNASET2
Alternative Gene Name: bA514O12.3, FLJ10907, RNASE6PL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094724: 62%, ENSRNOG00000013190: 60%
Entrez Gene ID: 8635
Uniprot ID: O00584
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYP
Gene Sequence LTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYP
Gene ID - Mouse ENSMUSG00000094724
Gene ID - Rat ENSRNOG00000013190
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNASET2 pAb (ATL-HPA066509)
Datasheet Anti RNASET2 pAb (ATL-HPA066509) Datasheet (External Link)
Vendor Page Anti RNASET2 pAb (ATL-HPA066509) at Atlas Antibodies

Documents & Links for Anti RNASET2 pAb (ATL-HPA066509)
Datasheet Anti RNASET2 pAb (ATL-HPA066509) Datasheet (External Link)
Vendor Page Anti RNASET2 pAb (ATL-HPA066509)