Anti RNASET2 pAb (ATL-HPA066509)

Atlas Antibodies

SKU:
ATL-HPA066509-25
  • Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ribonuclease T2
Gene Name: RNASET2
Alternative Gene Name: bA514O12.3, FLJ10907, RNASE6PL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094724: 62%, ENSRNOG00000013190: 60%
Entrez Gene ID: 8635
Uniprot ID: O00584
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYP
Gene Sequence LTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYP
Gene ID - Mouse ENSMUSG00000094724
Gene ID - Rat ENSRNOG00000013190
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RNASET2 pAb (ATL-HPA066509)
Datasheet Anti RNASET2 pAb (ATL-HPA066509) Datasheet (External Link)
Vendor Page Anti RNASET2 pAb (ATL-HPA066509) at Atlas Antibodies

Documents & Links for Anti RNASET2 pAb (ATL-HPA066509)
Datasheet Anti RNASET2 pAb (ATL-HPA066509) Datasheet (External Link)
Vendor Page Anti RNASET2 pAb (ATL-HPA066509)