Anti RNASET2 pAb (ATL-HPA066509)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066509-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RNASET2
Alternative Gene Name: bA514O12.3, FLJ10907, RNASE6PL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094724: 62%, ENSRNOG00000013190: 60%
Entrez Gene ID: 8635
Uniprot ID: O00584
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYP |
| Gene Sequence | LTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYP |
| Gene ID - Mouse | ENSMUSG00000094724 |
| Gene ID - Rat | ENSRNOG00000013190 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RNASET2 pAb (ATL-HPA066509) | |
| Datasheet | Anti RNASET2 pAb (ATL-HPA066509) Datasheet (External Link) |
| Vendor Page | Anti RNASET2 pAb (ATL-HPA066509) at Atlas Antibodies |
| Documents & Links for Anti RNASET2 pAb (ATL-HPA066509) | |
| Datasheet | Anti RNASET2 pAb (ATL-HPA066509) Datasheet (External Link) |
| Vendor Page | Anti RNASET2 pAb (ATL-HPA066509) |