Anti RNASE10 pAb (ATL-HPA052593)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052593-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RNASE10
Alternative Gene Name: RNASE9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021872: 66%, ENSRNOG00000010261: 65%
Entrez Gene ID: 338879
Uniprot ID: Q5GAN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YAFIHEDLNTVKAVCNSPVIACELKGGKCHKSSRPFDLTLCELSQPDQVTPNCNYLTSVIKKHIIITCNDMKRQLPTGQ |
Gene Sequence | YAFIHEDLNTVKAVCNSPVIACELKGGKCHKSSRPFDLTLCELSQPDQVTPNCNYLTSVIKKHIIITCNDMKRQLPTGQ |
Gene ID - Mouse | ENSMUSG00000021872 |
Gene ID - Rat | ENSRNOG00000010261 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RNASE10 pAb (ATL-HPA052593) | |
Datasheet | Anti RNASE10 pAb (ATL-HPA052593) Datasheet (External Link) |
Vendor Page | Anti RNASE10 pAb (ATL-HPA052593) at Atlas Antibodies |
Documents & Links for Anti RNASE10 pAb (ATL-HPA052593) | |
Datasheet | Anti RNASE10 pAb (ATL-HPA052593) Datasheet (External Link) |
Vendor Page | Anti RNASE10 pAb (ATL-HPA052593) |