Anti RMND5A pAb (ATL-HPA060843)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060843-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RMND5A
Alternative Gene Name: FLJ13910, GID2, GID2A, p44CTLH, RMD5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002222: 100%, ENSRNOG00000028422: 100%
Entrez Gene ID: 64795
Uniprot ID: Q9H871
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RELEKVLHKFSGYGQLCERGLEELIDYTGGLKHEILQSHGQDAELSGTLSLVLTQCCKRIKDT |
Gene Sequence | RELEKVLHKFSGYGQLCERGLEELIDYTGGLKHEILQSHGQDAELSGTLSLVLTQCCKRIKDT |
Gene ID - Mouse | ENSMUSG00000002222 |
Gene ID - Rat | ENSRNOG00000028422 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RMND5A pAb (ATL-HPA060843) | |
Datasheet | Anti RMND5A pAb (ATL-HPA060843) Datasheet (External Link) |
Vendor Page | Anti RMND5A pAb (ATL-HPA060843) at Atlas Antibodies |
Documents & Links for Anti RMND5A pAb (ATL-HPA060843) | |
Datasheet | Anti RMND5A pAb (ATL-HPA060843) Datasheet (External Link) |
Vendor Page | Anti RMND5A pAb (ATL-HPA060843) |