Anti RMDN3 pAb (ATL-HPA074840)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074840-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RMDN3
Alternative Gene Name: FAM82A2, FAM82C, FLJ10579, PTPIP51, RMD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070730: 80%, ENSRNOG00000011690: 83%
Entrez Gene ID: 55177
Uniprot ID: Q96TC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SQRWKRTQRHGRSQSLPNSLDYTQTSDPGRHVMLLRAVPGGAGDASVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAGEIVGE |
Gene Sequence | SQRWKRTQRHGRSQSLPNSLDYTQTSDPGRHVMLLRAVPGGAGDASVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAGEIVGE |
Gene ID - Mouse | ENSMUSG00000070730 |
Gene ID - Rat | ENSRNOG00000011690 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RMDN3 pAb (ATL-HPA074840) | |
Datasheet | Anti RMDN3 pAb (ATL-HPA074840) Datasheet (External Link) |
Vendor Page | Anti RMDN3 pAb (ATL-HPA074840) at Atlas Antibodies |
Documents & Links for Anti RMDN3 pAb (ATL-HPA074840) | |
Datasheet | Anti RMDN3 pAb (ATL-HPA074840) Datasheet (External Link) |
Vendor Page | Anti RMDN3 pAb (ATL-HPA074840) |